Protein Info for B158DRAFT_2463 in Kangiella aquimarina DSM 16071

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF19335: HMBD" amino acids 45 to 71 (27 residues), 35 bits, see alignment (E = 3.3e-12) PF16576: HlyD_D23" amino acids 106 to 313 (208 residues), 280.8 bits, see alignment E=1.8e-87 PF16572: HlyD_D4" amino acids 152 to 201 (50 residues), 30.8 bits, see alignment 6.6e-11 PF13437: HlyD_3" amino acids 211 to 310 (100 residues), 69.7 bits, see alignment E=9.9e-23 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 211 to 386 (176 residues), 121.5 bits, see alignment E=1.8e-39 PF11604: CusF_Ec" amino acids 413 to 479 (67 residues), 71.5 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 64% identity to kko:Kkor_1608)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>B158DRAFT_2463 RND family efflux transporter, MFP subunit (Kangiella aquimarina DSM 16071)
MKKSTLTTVVSAAIVGAVLGVSLSTWLGDSGSSTNNNAGPKEPLYWVAPMDPNYRRDKPG
KSPMGMDLVPVYEEAQDSESPGTVSISAAVENNIAVRTDTVKYGTLNNAIKTVGYVQFNQ
DQLIHIHPRVEGWVEKLFVKASGDPVKKDQPLYELYSPQLVNAQEEYVLALKRNSGELIQ
AARNRLRALQLPESFIQQLGKKRQVKQTVTFYSPQDGVIDQLSIREGFYVQPGTTMMSIG
TLEQVWVEAEVFERQAELLKIGLPVTMSLDYFNGQSWKGEIDYIYPSLDSTNRTLRVRIR
FNNPDHKLKPNMFSQIVIHADSDKRQLLVPKEAVIRTQKQDRVVLDLGDGKFKSVEVLLG
ATGDKFFEVIEGLEEDDRVVTSAQFLIDSESSKSSDFKRLSQEDENESIWVEATINSVMA
HHNMLNVSHGPVEQWQWPAMTMDLNTQEDLDLSQLKSGMTVHIEISKLSDGSFMITEIHI
PDQNDKQQDEEVDHSTMDHSTMDHSTMDHSTMDHSTMDHSTMDHSTMDHSTMDHSTMDHS
TMDHSSTDEENKE