Protein Info for B158DRAFT_2424 in Kangiella aquimarina DSM 16071

Annotation: 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase (EC 2.5.1.54)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18152: DAHP_snth_FXD
  • amino acids 1 to 66 (66 residues), 60.6 bits, E=1.6e-20
• TIGR01361: 3-deoxy-7-phosphoheptulonate synthase
  • amino acids 71 to 326 (256 residues), 383.8 bits, E=1.9e-119
• PF00793: DAHP_synth_1
  • amino acids 93 to 326 (234 residues), 262.6 bits, E=4.3e-82
• PF03102: NeuB
  • amino acids 143 to 334 (192 residues), 41.2 bits, E=2.1e-14

Best Hits

Swiss-Prot: 52% identical to AROF_THEMA: Phospho-2-dehydro-3-deoxyheptonate aldolase (aroF) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K03856, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 96% identity to kko:Kkor_1648)

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I beta (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)
• superpathway of chorismate metabolism (41/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Protein Sequence (344 amino acids)

>B158DRAFT_2424 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase (EC 2.5.1.54) (Kangiella aquimarina DSM 16071)
MIIILRPDASEQDAQEILQKIDTAGLKPLHMPGIERTVIGALGDERVLESLHLENLPQVD
MVKPVLSKYKLVSREIYAQDTVVQVGNTPVGSEQFAIMAGPCAIESEEQLLETARYVKNA
GATVLRGGAFKPRTSPYSFQGLGVEGLKIMSQVGKEVGLDTITELMDVKDLDDVARYISA
IQIGARNMQNYTLLKAVGETQKPVLLKRGLSATIEELLLAAEYIVASGNPNVMICERGIR
TFETATRNTLDLNAVAFIKERSHLPVIVDPSHGTGVRTLVSPMAKAAVACGADGVIVECH
RSPKESVSDAAQALSPQDFHNLMQQLAPFVTASGRTLAEVARAS