Protein Info for B158DRAFT_2423 in Kangiella aquimarina DSM 16071

Annotation: ATPases involved in chromosome partitioning

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13614: AAA_31
  • amino acids 4 to 53 (50 residues), 38.6 bits, 2.2e-13
  • amino acids 69 to 141 (73 residues), 31.4 bits, E=3.6e-11
• PF07015: VirC1
  • amino acids 4 to 184 (181 residues), 48.3 bits, E=1.7e-16
• PF09140: MipZ
  • amino acids 5 to 155 (151 residues), 27.1 bits, E=5e-10
• PF01656: CbiA
  • amino acids 6 to 134 (129 residues), 38.2 bits, E=2.6e-13

Best Hits

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 95% identity to kko:Kkor_1649)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Protein Sequence (236 amino acids)

>B158DRAFT_2423 ATPases involved in chromosome partitioning (Kangiella aquimarina DSM 16071)
MRAKVISFVQMKGGAGKTTLCANIASTLSDKSKVLMIDTDHPQSSLETWYRVRDEQYLIE
NMDVISAKNLAHLQKQVRENTDLYDYILIDGHPRITNLTRAVVLLSDLALIPLSPSPIEV
WSTKHLAEIVDEAKAMNPNLEARICWNRYRVRTNSADNVVSNAKQELGLEDFPTKLGNRV
AYLDSFAEGLTVAEWHDPAAKLEIWSLTSNIERLISQLPKSRLKTENQVDKFAKGK