Protein Info for B158DRAFT_2404 in Kangiella aquimarina DSM 16071

Annotation: integral membrane protein MviN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details amino acids 442 to 462 (21 residues), see Phobius details amino acids 478 to 502 (25 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 3 to 502 (500 residues), 471.3 bits, see alignment E=2e-145 PF03023: MurJ" amino acids 29 to 471 (443 residues), 470 bits, see alignment E=7.3e-145 PF14667: Polysacc_synt_C" amino acids 355 to 502 (148 residues), 57.6 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 52% identical to MURJ_HAEIN: Probable lipid II flippase MurJ (murJ) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03980, virulence factor (inferred from 96% identity to kko:Kkor_1667)

MetaCyc: 47% identical to lipid II flippase MurJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-286

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>B158DRAFT_2404 integral membrane protein MviN (Kangiella aquimarina DSM 16071)
MGSLLKSSTIVSFWTMISRIMGLVRDVVLANLLGATFQADVFLVAQKIPNFLRRLFGEGA
FATAFVPVFSEYYSNRTQKDTVQLLSKVSGTLGGVLAIVTIVGVLGSQGLIAIFGIGFLD
EPEKFNLASDLLKITFPYIFFISLVAMYSSVLNTLNKFAVPAFAPILLNLSIIAAAIVFA
PTMEEPTVALAWAIFIAGALQLFLHFPFLWKAGYLPKPQWAWKDSGVQRIIKLMIPVIFG
ASVSQINLLIDTQIASLLVEGSISWLYYSDRLLEFPLGIFGIAIATVLLPTLSKFFSKKD
MQHYSGTLDWGLRMVLMIGIPAAIGLFWLAEPIMITVFQHGAFTEYDSFKAGQSLQAYSS
GLIAFMMVKVFLTGFYSRQDTKTPVKIAVVAVVSNIVLNLALFKPFGHVGLAAATSISAF
INAILLYRFLSKDNHLKLSRESKLWIGKLILASGLLLLGLWYTDFSIEQWQAWSRLEAIG
MISTIIAVTIVAYAILLVLLGLRRKDFRIGQ