Protein Info for B158DRAFT_2392 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized low-complexity proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 PF00805: Pentapeptide" amino acids 33 to 52 (20 residues), 15.4 bits, see alignment (E = 2.3e-06) amino acids 40 to 78 (39 residues), 28.4 bits, see alignment 1.9e-10 amino acids 56 to 91 (36 residues), 24.8 bits, see alignment 2.5e-09 amino acids 79 to 111 (33 residues), 27.2 bits, see alignment (E = 4.5e-10) amino acids 114 to 153 (40 residues), 33.3 bits, see alignment 5.6e-12 amino acids 139 to 177 (39 residues), 37.3 bits, see alignment 3.2e-13 amino acids 155 to 193 (39 residues), 35.5 bits, see alignment 1.1e-12 amino acids 179 to 218 (40 residues), 38.9 bits, see alignment 1e-13 amino acids 215 to 247 (33 residues), 33.5 bits, see alignment (E = 4.9e-12) PF13599: Pentapeptide_4" amino acids 77 to 157 (81 residues), 29.5 bits, see alignment E=1.4e-10 amino acids 151 to 211 (61 residues), 30.2 bits, see alignment E=8.6e-11 PF00211: Guanylate_cyc" amino acids 465 to 549 (85 residues), 34.8 bits, see alignment E=2.7e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to kko:Kkor_1679)

Predicted SEED Role

"Uncharacterized low-complexity proteins-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>B158DRAFT_2392 Uncharacterized low-complexity proteins (Kangiella aquimarina DSM 16071)
MSLTSEDNKELLNILMQGEKVWNQWRKENPKTHANFDGQDLRGLDLSGCDLSEMSFVGAN
LAYSDLQGVALIASNLTDANLCYCNLTGAKLIAANLKQANLSHANLLHANLLTAICFRTD
LSSVDLRDHDLRGQDLREANLSGADLRNQNLEGLDMQGAKLIGTKMDNVNLRDTNLNKAN
LSDVDLSSCRIEGVSLKSANLSNANLSGLDLSGFNLSGVNFKGADLRSANLTKANLDNAI
LSAAKLWQVQTNGWSIRNIECSHASWDQRGRDYTHYAKNQFEKLFADKITFTLRYQRMLS
YQDLATLPFLIEHLEASYWGCKLRIRDIRNEPGDTRAIIVVEDTGGLNPTMLEASLRQEA
EKLQSIQISLQSERKLQFEIRESLQAIKDKYWPKLLELSEIDSDAKTRRLAVLFTDLKGF
SHWTEEDRTEKLSLFRGLLKPVLKKWQASYPNMEGDSLRATFQNVESALSCAAMIQKVLA
GAGFALRIGLDIGEVKITHNEITEQLDIEGDAINFAARLESMAEPGEVLVSENVRHYAIQ
ADSAFTFKEQRLALKKAVGDKQAGDKIVCYSAQPLAFVQPPES