Protein Info for B158DRAFT_2369 in Kangiella aquimarina DSM 16071

Annotation: electron transport complex, RnfABCDGE type, C subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 13 to 446 (434 residues), 574.6 bits, see alignment E=5.3e-177 PF13375: RnfC_N" amino acids 14 to 115 (102 residues), 110.7 bits, see alignment E=2.2e-35 PF05896: NQRA" amino acids 32 to 214 (183 residues), 36.7 bits, see alignment E=2.5e-12 PF01512: Complex1_51K" amino acids 140 to 285 (146 residues), 161.2 bits, see alignment E=1.3e-50 PF10531: SLBB" amino acids 297 to 343 (47 residues), 27.1 bits, see alignment 2.1e-09 PF13183: Fer4_8" amino acids 374 to 429 (56 residues), 36.8 bits, see alignment 3.3e-12 PF13237: Fer4_10" amino acids 375 to 426 (52 residues), 41.7 bits, see alignment 6.7e-14 PF12838: Fer4_7" amino acids 376 to 429 (54 residues), 42 bits, see alignment 7.4e-14 PF12798: Fer4_3" amino acids 376 to 387 (12 residues), 15.1 bits, see alignment (E = 2.5e-05) amino acids 415 to 429 (15 residues), 17.5 bits, see alignment (E = 4.2e-06) PF12800: Fer4_4" amino acids 376 to 388 (13 residues), 18.7 bits, see alignment (E = 1.2e-06) amino acids 414 to 426 (13 residues), 15.7 bits, see alignment (E = 1.1e-05) PF13187: Fer4_9" amino acids 376 to 428 (53 residues), 36.6 bits, see alignment 2.6e-12 PF13534: Fer4_17" amino acids 376 to 430 (55 residues), 31.6 bits, see alignment 1.4e-10

Best Hits

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 87% identity to kko:Kkor_0941)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>B158DRAFT_2369 electron transport complex, RnfABCDGE type, C subunit (Kangiella aquimarina DSM 16071)
MERSNYKSEIPIFEFHGGIHPKEHKLESNQTPIQKIPLPQQLAINLKGQAGNRSLPIVNV
GDKVLKGQVIAESDGIFSTFQHAPCSGTVVAIEKRPIAHPSGLDDLCVVIETDSKDQWCE
LFPKKNIHELERAEILAHICESGIVGLGGASFPTHIKLKRESGIDTLIINAAECEPYITC
DDRLLQERAADVLRGAQIISHLYDDINIIVGIEDNKPNAIDALVDARKQLEMDTVKIAVV
PTKYPSGGEKQLIQLLTGEEVPHGGLPADLGLVMHNVATCVAIYEAFEFGKPLVSRVVTL
TGEACQKPGNYEVPFGTPVEHLMSFCNATNPGVLVMGGPMMGFELPNPKVGIVKATNCII
MAAPKELKHDHLALPCIRCGACMDACPASLLPQQLYWHAKADEFEKAEEYDLFDCIECGA
CAYVCPSDIPLVQYYRYAKSTIRNQKVEKTKADKARLRHEARNERLERVKREKAEKHRKA
AEARRKAAEAAGEDDAKKAAVAAALARVKAKKAQQDDSDTKTESNDQKDTDA