Protein Info for B158DRAFT_2366 in Kangiella aquimarina DSM 16071

Annotation: electron transport complex, RnfABCDGE type, E subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 22 to 52 (31 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 8 to 210 (203 residues), 269.1 bits, see alignment E=9.7e-85 PF02508: Rnf-Nqr" amino acids 8 to 202 (195 residues), 216.2 bits, see alignment E=1.7e-68

Best Hits

Swiss-Prot: 66% identical to RNFE_VIBVY: Ion-translocating oxidoreductase complex subunit E (rnfE) from Vibrio vulnificus (strain YJ016)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 94% identity to kko:Kkor_0938)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>B158DRAFT_2366 electron transport complex, RnfABCDGE type, E subunit (Kangiella aquimarina DSM 16071)
MINSEHKTIIKNGLWDNNPALVQLLGLCPLLAVSNTFINGLALGLATTWVLAGSNASVSL
VRNYIPKEIRIPIFVMMIASFVTNVGLIMNAFTYELYLTLGIFIPLIVTNCAIIGRAEAF
ASKNKFFPSLLDGVMQGLGFTAVLCTLGALREMIGQGTLFSGAEQLFGEWAIDLTISFYL
TDSTFLFAILPPGAFVGLGILIAIKNGIDNKRAEQAKATKTSPIKNEEALGHE