Protein Info for B158DRAFT_2362 in Kangiella aquimarina DSM 16071

Annotation: Di- and tricarboxylate transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 28 to 45 (18 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 134 to 160 (27 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 385 to 414 (30 residues), see Phobius details amino acids 434 to 458 (25 residues), see Phobius details amino acids 474 to 494 (21 residues), see Phobius details amino acids 497 to 539 (43 residues), see Phobius details amino acids 559 to 580 (22 residues), see Phobius details PF03600: CitMHS" amino acids 19 to 526 (508 residues), 150.8 bits, see alignment E=5.3e-48 PF02080: TrkA_C" amino acids 210 to 266 (57 residues), 27.6 bits, see alignment 2.1e-10 amino acids 296 to 352 (57 residues), 42.6 bits, see alignment 4.5e-15

Best Hits

KEGG orthology group: None (inferred from 87% identity to kko:Kkor_0935)

Predicted SEED Role

"Sulfate permease, Trk-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>B158DRAFT_2362 Di- and tricarboxylate transporters (Kangiella aquimarina DSM 16071)
MLLEQVYVFSIIIAMLVGLVMNLARPAWLFSMAALALYFPGFVSAERFFSHAVNPAVLTL
ILLLICSLALERTRALAWISKQLFSKSQFFTLVKMGGLVAASSAFLNNTAIVASLMGAVR
NNSSQPAKRLLIPLSYFAILGGTLTLIGTSTNLVVNSFLVDYGEPGFNFFDFLPVGLIIL
LVSGVAVIVVSYWLPEESVTGTVSREYFLEAKVDSDSILIGKTIYQAGLTTITGLDLVEV
VRNEQVIAPVEHNFELQQGDLLIYCGDVKLAKQLASVKGLSVFAEDSGLLDKHLKEVIVS
PMSTLIGRTLKQSSFRAHFDAAVVAIGRNGGRLSGALGEVEIRAGDKLVIATGLDFYKRP
NVERNFIFLDKVQLHPPLKLSQEIITFAGFFVAVTLAATGLVNLLTAMMGYLILILATKV
ISTTEVRRRLPLEIWLVIASALAIADVFNQVGVASLIARAVTGMFQIDGSNDLTGIYLSF
ISIYLLTWIITEMVTNNAAAALMFPVAFGLAESIGVNYMPFVMAVAYGASASFISPFGYQ
TNLMVMNVGSYSFRDFARVGWLVSLSFTIVALIAIPIVFPFS