Protein Info for B158DRAFT_2359 in Kangiella aquimarina DSM 16071

Annotation: bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR00696: glycosyltransferase, WecB/TagA/CpsF family" amino acids 65 to 236 (172 residues), 172.1 bits, see alignment E=4.8e-55 PF03808: Glyco_tran_WecG" amino acids 68 to 230 (163 residues), 161 bits, see alignment E=1.2e-51

Best Hits

Swiss-Prot: 40% identical to WECG_CITK8: UDP-N-acetyl-D-mannosaminuronic acid transferase (wecG) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02852, UDP-N-acetyl-D-mannosaminuronic acid transferase [EC: 2.4.1.-] (inferred from 66% identity to kko:Kkor_0932)

MetaCyc: 39% identical to UDP-N-acetyl-D-mannosaminuronic acid transferase (Escherichia coli K-12 substr. MG1655)
Lipopolysaccharide N-acetylmannosaminouronosyltransferase. [EC: 2.4.1.180]

Predicted SEED Role

"Probable UDP-N-acetyl-D-mannosaminuronic acid transferase (EC 2.4.1.-)" (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>B158DRAFT_2359 bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family (Kangiella aquimarina DSM 16071)
MTEFLTCRSGASVSVGGLPIKPYHCLEDAVSAIINSANMEGGFAVAVNAEKVISAMKDEN
LKDCLLSASLLYADGISVVKTIKSKGVVNSRIPGCELWVELMKKVAESGQSVYLLGATEE
TNKATAKKLKEQFGVHNLTRRNGFFEDEESIIDEVVRLKPEIVTVALGSPRQEFLIAKLR
EVHPGAFYMGVGGSYDVFVGKIRRAPKLLRQLHLEWLYRLITEPRRIVRQFSLLHYFVLH
VAGKL