Protein Info for B158DRAFT_2358 in Kangiella aquimarina DSM 16071

Annotation: UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 80 to 96 (17 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 190 to 207 (18 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 82 to 240 (159 residues), 119.5 bits, see alignment E=7.3e-39

Best Hits

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>B158DRAFT_2358 UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase (Kangiella aquimarina DSM 16071)
MENLLEDITDHVLFQAEGMIALILVLAGLPILRRAAPKVGLVDHPGGRKRQCTPTPLVGG
IAIFLAVTTTLFTSTLFSEFKGLILGASALFVVGLLDDRFDLQAKLRFVLQAIIVSIALS
IDGVWLSSLGSLAGVDLQLGILQYPITVLAVLGVINAINMLDGLDGLASGVVLLTLFFIL
GFSVESGSEVVLISSSLLGATLGFWLYNYRFRWREKASVYMGDSGTILLGFSLSYIAIYL
TLPQKTTNTLEPAYLLWLFALPLWDITTVLFKRIKSGRSPFLAGRDHIHHILLNHELSVR
QTVLLIYGATLLGLSLGTSLYYFKFGSVGLYLSFIASLLFYIKVILRFEQKISAEVIELD
ISKSKSTNKKKQSKI