Protein Info for B158DRAFT_2337 in Kangiella aquimarina DSM 16071

Annotation: Sulfate permease and related transporters (MFS superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 44 to 60 (17 residues), see Phobius details amino acids 65 to 81 (17 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 353 to 383 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 14 to 347 (334 residues), 177.8 bits, see alignment E=2.9e-56 PF01740: STAS" amino acids 395 to 483 (89 residues), 44.3 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 56% identical to YBAR_BACSU: Putative sulfate transporter YbaR (ybaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 91% identity to kko:Kkor_0908)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>B158DRAFT_2337 Sulfate permease and related transporters (MFS superfamily) (Kangiella aquimarina DSM 16071)
MLQTIKRDWFSNIRGDLLAGLVVALALIPEAIAFSIIAEVDPKVGLYASFCIAVIIAFVG
GRPGMISAATGAMALLMVTLVKEHGLQYLLAATVLTGVLQIIAGFLRLDNLMRFVSRSVV
TGFVNALAILIFMAQVPELINVTWHVYAVAIAGLCIIYLFPLIPVIGKVIPSPLVCIVGL
TIIVVALGWEIPNVGGKGELPDTLPVFLWPDVPLNLDTLIIIFPYSAALAVVGLLESLMT
AGIVDDLTDTTSNKNRECKGQGIANIGAGLMGGMAGCAMIGQSVINVKSGGRGRLSTFVA
GIVLIILVVFLDEWISLIPMAALVAVMTMVSIGTFSWSSIRDLRKHPMSTNLVMVTTVAV
VVATHNLAIGVFVGVLMAALFFANKISRFMVIKRKAEQTDLTRYYEVIGQVFFASAEKFI
GSFDFKEAIDEVTIDLSHAHFWDITAVGALDNVVIKFRREGTHVNVVGLNEASKTVVDKF
SIYDNPEEVEKLMSGH