Protein Info for B158DRAFT_2330 in Kangiella aquimarina DSM 16071

Annotation: Predicted N-acetylglucosaminyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF13176: TPR_7" amino acids 74 to 101 (28 residues), 23.1 bits, see alignment (E = 3.4e-08) PF13174: TPR_6" amino acids 112 to 138 (27 residues), 13 bits, see alignment (E = 8.3e-05) amino acids 223 to 246 (24 residues), 13.7 bits, see alignment (E = 5.1e-05) PF13181: TPR_8" amino acids 183 to 215 (33 residues), 14.4 bits, see alignment 2.1e-05 amino acids 219 to 245 (27 residues), 13.7 bits, see alignment (E = 3.7e-05) PF14559: TPR_19" amino acids 196 to 247 (52 residues), 35 bits, see alignment 8.6e-12 PF13432: TPR_16" amino acids 197 to 247 (51 residues), 31.5 bits, see alignment 1.2e-10 PF18073: Rubredoxin_2" amino acids 357 to 384 (28 residues), 41.7 bits, see alignment (E = 4.4e-14)

Best Hits

Swiss-Prot: 41% identical to LAPB_ECOL6: Lipopolysaccharide assembly protein B (lapB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 90% identity to kko:Kkor_0901)

Predicted SEED Role

"Heat shock (predicted periplasmic) protein YciM, precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>B158DRAFT_2330 Predicted N-acetylglucosaminyl transferase (Kangiella aquimarina DSM 16071)
MNDWFLYGVLALLPIAAYSGYRLGRKQRKEQKSSNGSLSSNYIKGLNYLLNEQADKAVDT
FIDLLTVDTDTVETHLALGNLFRKRGEVDRAIRLHQNLIARPQLKTEDRNTALYQLGLDY
NAVGMYDRAVSLFNELLSDPEHKSESLHQLLNIYQLTKDWDQAAKIAEQLQSSLGEEQSK
PLAHFYCELADQKQIEGDIKAALANLKKALSINPDSVRASILQGDIYLQQSNFKQAIKAY
QRILKQDIAFLPEALPKIAEAYNAQHDLKGYKQFLNESLQHDAGVSLLIELSKIIQKESG
DKAAALLIGEYLQDKPSLKGLHRLISLHIEHAQESAKPSLQLLDGIVEKLLQRKPRYECQ
NCGFHTKAIYWQCPSCKEWSSVKPIKGIEGE