Protein Info for B158DRAFT_2319 in Kangiella aquimarina DSM 16071

Annotation: 3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 15 to 233 (219 residues), 296.1 bits, see alignment E=7.2e-93 PF02353: CMAS" amino acids 37 to 165 (129 residues), 44.9 bits, see alignment E=5.5e-15 PF01209: Ubie_methyltran" amino acids 44 to 181 (138 residues), 41.7 bits, see alignment E=4.9e-14 PF08003: Methyltransf_9" amino acids 47 to 159 (113 residues), 24.7 bits, see alignment E=6.2e-09 PF05219: DREV" amino acids 49 to 157 (109 residues), 28.5 bits, see alignment E=4.6e-10 PF05175: MTS" amino acids 53 to 126 (74 residues), 27.5 bits, see alignment E=1.2e-09 PF13489: Methyltransf_23" amino acids 53 to 205 (153 residues), 88.7 bits, see alignment E=2e-28 PF06325: PrmA" amino acids 53 to 159 (107 residues), 33 bits, see alignment E=2.6e-11 PF13847: Methyltransf_31" amino acids 56 to 160 (105 residues), 65.4 bits, see alignment E=2.7e-21 PF13649: Methyltransf_25" amino acids 59 to 152 (94 residues), 65.2 bits, see alignment E=4.1e-21 PF08242: Methyltransf_12" amino acids 60 to 154 (95 residues), 61.6 bits, see alignment E=5.5e-20 PF08241: Methyltransf_11" amino acids 60 to 156 (97 residues), 72 bits, see alignment E=3e-23

Best Hits

Swiss-Prot: 69% identical to UBIG_PSEAE: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 95% identity to kko:Kkor_0890)

MetaCyc: 65% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>B158DRAFT_2319 3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64) (Kangiella aquimarina DSM 16071)
MSNTTENQANVDQHEINKFEQMASRWWDKEGDFKPLHDINPLRLQFILDQANGLQGKKVL
DIGCGGGILTESMAKEGAQVSGIDMGEMPLEVAKLHMLESGLDIDYQKITAEEFAEKHAG
EFDVVTCLEMLEHVPDPSSIIQACRKLVKPDGHVFFSTINRNPKSFLFAIVGAEYILQML
PKGTHDFKKFIRPSELEAWSRPAGLPFQSIIGMHYNPLTKKYWLSDNVDVNYLVHTRPE