Protein Info for B158DRAFT_2318 in Kangiella aquimarina DSM 16071

Annotation: 2-phosphoglycolate phosphatase, prokaryotic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00702: Hydrolase" amino acids 6 to 182 (177 residues), 92.1 bits, see alignment E=1.2e-29 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 8 to 216 (209 residues), 167.7 bits, see alignment E=3.9e-53 PF13419: HAD_2" amino acids 8 to 187 (180 residues), 112.5 bits, see alignment E=5.4e-36 PF12710: HAD" amino acids 8 to 178 (171 residues), 34 bits, see alignment E=8.1e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 83 to 182 (100 residues), 30.1 bits, see alignment E=8.4e-11 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 94 to 187 (94 residues), 35.6 bits, see alignment E=1.5e-12 PF13242: Hydrolase_like" amino acids 145 to 210 (66 residues), 38.3 bits, see alignment E=2e-13

Best Hits

Swiss-Prot: 40% identical to MUPP_PSEAE: N-acetylmuramic acid 6-phosphate phosphatase (mupP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 88% identity to kko:Kkor_0889)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ubiquinone biosynthesis SAM-dependent O-methyltransferase" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>B158DRAFT_2318 2-phosphoglycolate phosphatase, prokaryotic (Kangiella aquimarina DSM 16071)
MLNNLRAVFFDLDGTLLDTAPDMALALNIQREVHGKEPLPFSDIRPYVSHGAAAMLRIGF
GLEPGHKDFDEFRKQYLNIYADNIAVHTELFAGLKELLNTLTESDIAWGIATNKPEFLTI
PLLEALNLRESCSGLVCGDTVKPTKPHPKPLFFAAQQAGVKPVQSVYVGDAWRDIAAGRA
AGMKTVVAEYGYIQPEDKILEWKADAVAKESTDLIKMLLNR