Protein Info for B158DRAFT_2304 in Kangiella aquimarina DSM 16071

Annotation: Predicted metal-dependent phosphoesterases (PHP family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF02811: PHP" amino acids 4 to 141 (138 residues), 47.4 bits, see alignment E=1.5e-16

Best Hits

Swiss-Prot: 41% identical to RNAAM_ECOLI: 5'-3' exoribonuclease (yciV) from Escherichia coli (strain K12)

KEGG orthology group: K07053, (no description) (inferred from 94% identity to kko:Kkor_0871)

MetaCyc: 41% identical to RNase AM (Escherichia coli K-12 substr. MG1655)
RXN-16009 [EC: 3.1.3.97]; 3.1.13.- [EC: 3.1.3.97]; RXN-24047 [EC: 3.1.3.97]

Predicted SEED Role

"COG0613, Predicted metal-dependent phosphoesterases (PHP family)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.97

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>B158DRAFT_2304 Predicted metal-dependent phosphoesterases (PHP family) (Kangiella aquimarina DSM 16071)
MLRDLHNHTHASDGSLSPLELVELAVERGVDELAITDHDSVAGVLALRKQPQGFDLKIIE
GVEISAGWGKHTLHIVGLNIDPEHSGLSSFLKLQQQKRHTRALEMAHKMQKAGVEQAVED
VETMLQEQNMVCRTHLAQYLLDKGVVNNFTNAFKKYLAKGGKAFVKDDWFELEDAIAIIK
QAGGVPVLAHPTRYKMGSNQLHELIQAFQRMGGQAIEVCYPNIHPGKKNLLANWVQKYNL
LASQGSDFHSPDKPWALLGKFPPMPDNVTPVWEAWQ