Protein Info for B158DRAFT_2303 in Kangiella aquimarina DSM 16071

Annotation: Intracellular septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details PF04279: IspA" amino acids 1 to 179 (179 residues), 94.6 bits, see alignment E=4.4e-31

Best Hits

KEGG orthology group: K06190, intracellular septation protein (inferred from 90% identity to kko:Kkor_0870)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>B158DRAFT_2303 Intracellular septation protein A (Kangiella aquimarina DSM 16071)
MTFLKENYPLVAFIAVYLITKNLILAAAVWSAGSLVQILTSVFTKQPIKKSHIAYFILGV
LLVASAYYFDDENFIKWKTSIILWAGALFILFRQLFSKKYIIQDLLKANNVLKDTAPQSL
LAKINWLWIVYLTGFSFLNLYIAYTFSTDVWFWFKIIGLFVSTFLLFIISIIMLKEHVNL
DDPQDSNPHNKDSQE