Protein Info for B158DRAFT_2297 in Kangiella aquimarina DSM 16071

Annotation: protein-L-isoaspartate(D-aspartate) O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 13 to 220 (208 residues), 239.6 bits, see alignment E=1.7e-75 PF01135: PCMT" amino acids 19 to 219 (201 residues), 216.8 bits, see alignment E=3e-68 PF00398: RrnaAD" amino acids 87 to 177 (91 residues), 26.7 bits, see alignment E=2.9e-10

Best Hits

Swiss-Prot: 59% identical to PIMT_ALCBS: Protein-L-isoaspartate O-methyltransferase (pcm) from Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 94% identity to kko:Kkor_0864)

MetaCyc: 53% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>B158DRAFT_2297 protein-L-isoaspartate(D-aspartate) O-methyltransferase (Kangiella aquimarina DSM 16071)
MNAAHFSGIGMTSARTRGRLVQRLMAEGISNQQVLKAIEDTPRHVFIDEGLSHRAYEDTA
LPIGMGQTISQPYIVARMTQALLESGPMNKVLEIGTGCGYQTAILSKLCKTVFTVERIRA
LHMQARKTLGQLGIHNVQYLFADGFNGWLQNAPFDAIIVTAAPAQIPEKLLAQLADGGRM
IIPVGQTETAQELVLVERQGDEFKQTVIEKVKFVPLVSGVAR