Protein Info for B158DRAFT_2295 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF01142: TruD" amino acids 18 to 174 (157 residues), 119 bits, see alignment E=1.2e-38 amino acids 193 to 341 (149 residues), 74.1 bits, see alignment E=5.4e-25

Best Hits

Swiss-Prot: 37% identical to TRUD_PSEA6: tRNA pseudouridine synthase D (truD) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K06176, tRNA pseudouridine synthase D [EC: 5.4.99.12] (inferred from 85% identity to kko:Kkor_0862)

Predicted SEED Role

"tRNA pseudouridine 13 synthase (EC 4.2.1.-)" in subsystem tRNA processing (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 5.4.99.12

Use Curated BLAST to search for 4.2.1.- or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>B158DRAFT_2295 Uncharacterized conserved protein (Kangiella aquimarina DSM 16071)
MELKLYDWPRAYGAPLASATFRQQLSDFCVDEELRFEPSGEGAHHLLLIEKRNINTDIVC
HKLRRFAEVNTTDIGYAGKKDRFAIARQWFSVQLPLLKEIDWTEFNDDEVTVLKATRHDK
KLRIGAVKQNHFKITLRDIGFKEGADKNSLEQRIAKIQQHGFANYFGEQRFGRNGDNLAR
GVDLLLANKKLKNRNLQGLLFSAVRSFLFNQVVAKRIEAGQFSELLDGDYVQLDGSESGF
TVQDLSQELPRFTAKDIHPTAPMPGRGRSQVLAKAAEFESAVLEPFQPIIDALERKGLNG
ERRAIRVFPQNVILQWHNEQTLEMRFSLPKGAFATSLLRELFELNIDKPDTFND