Protein Info for B158DRAFT_2287 in Kangiella aquimarina DSM 16071

Annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR00070: ATP phosphoribosyltransferase" amino acids 3 to 181 (179 residues), 149.3 bits, see alignment E=1.1e-47 PF01634: HisG" amino acids 49 to 202 (154 residues), 134 bits, see alignment E=4.5e-43 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 182 to 281 (100 residues), 91.6 bits, see alignment E=3e-30 PF08029: HisG_C" amino acids 209 to 280 (72 residues), 75.6 bits, see alignment E=2.7e-25

Best Hits

Swiss-Prot: 34% identical to HIS1_SULAC: ATP phosphoribosyltransferase (hisG) from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 94% identity to kko:Kkor_0854)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>B158DRAFT_2287 ATP phosphoribosyltransferase (Kangiella aquimarina DSM 16071)
MALKMVIPKGKLYDKVSELLSDIGLTLVGDSRNYRPQLFGCDIEVKLLKSQNIPEMVALG
QHDIGFAGMDWILEQEADVEVLEDLGFNPVKLVSCIPEEWDWNEVKQRKIIVASEYKKIS
AKYLDQLGVPYQLLRAYGATEVFPPEDADMVIDNTSTGSTIRANRLKIVDTVMESSTQFI
ANKSVLDDPEKRKQIDDLLLLMRGVLNGRKRVLLEMNCSEDSIDKVVDLLPAMRAPTVSR
LYNADGFAIKAAIERKLIKDLLPKLITAGATDILETPIRKVL