Protein Info for B158DRAFT_2275 in Kangiella aquimarina DSM 16071

Annotation: 23S rRNA (uracil-5-)-methyltransferase RumA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 23 to 440 (418 residues), 349.6 bits, E=1.2e-108
• PF05958: tRNA_U5-meth_tr
  • amino acids 277 to 447 (171 residues), 103.3 bits, E=7.3e-33
• PF02475: Met_10
  • amino acids 278 to 365 (88 residues), 21.1 bits, E=1.2e-07
• PF01135: PCMT
  • amino acids 285 to 357 (73 residues), 23.1 bits, E=2.9e-08
• PF00398: RrnaAD
  • amino acids 285 to 349 (65 residues), 28.6 bits, E=3.9e-10
• PF03602: Cons_hypoth95
  • amino acids 295 to 404 (110 residues), 26.1 bits, E=3.3e-09
• PF05175: MTS
  • amino acids 296 to 390 (95 residues), 30.9 bits, E=1e-10
• PF13847: Methyltransf_31
  • amino acids 302 to 379 (78 residues), 50.4 bits, E=1.1e-16
• PF13649: Methyltransf_25
  • amino acids 306 to 361 (56 residues), 35.7 bits, 5.7e-12
• PF08241: Methyltransf_11
  • amino acids 307 to 361 (55 residues), 22.3 bits, 8.5e-08

Best Hits

Swiss-Prot: 57% identical to RLMD_MARHV: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 94% identity to kko:Kkor_0842)

Predicted SEED Role

"RNA methyltransferase, TrmA family"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (448 amino acids)

>B158DRAFT_2275 23S rRNA (uracil-5-)-methyltransferase RumA (Kangiella aquimarina DSM 16071)
MARRRRRKPLPTEPVRASIHAFSHEGRGICSVEGKTVFVDNALKGEDVSFQYTEKRGKFD
EGVAIEIHSSSEDRVTPPCEHADICGGCSLQHMSNPAQIHHKQNVLVEQFEHFGGYSHKN
GDYELVEPLQADVLGYRRKARLGVKYVPKKGGALVGFREKRSNFLANIDSCLVLDPRVGQ
LITPLKNMISELDSNDKTAQLEVAMGDDQVALVVRHLVPLTEKDQNLWIEFGKEHGLYIY
LQPKGPDTVHLLYGPDTRDWLSYRFDDYDVEMLFHPMDFTQVNASINQKMVKRAIEWLEP
KAEDRILDLFCGLGNFTIPLATQAQNVVGVEGSEAMVERGQMNAKHNNLSNVEFHATNLQ
DDFTQEEWAQQGFNKILIDPPRSGALDVVQNITRFNPERIVYVSCNPATLARDAGELKER
GYKLVKAGVMDMFPHTSHTESIALFERG