Protein Info for B158DRAFT_2271 in Kangiella aquimarina DSM 16071

Annotation: MiaB-like tRNA modifying enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF00919: UPF0004" amino acids 3 to 96 (94 residues), 80.2 bits, see alignment E=9.4e-27 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 3 to 416 (414 residues), 385.6 bits, see alignment E=2.9e-119 TIGR01579: MiaB-like tRNA modifying enzyme" amino acids 6 to 399 (394 residues), 396.6 bits, see alignment E=1.7e-122 PF04055: Radical_SAM" amino acids 139 to 308 (170 residues), 80.1 bits, see alignment E=2.3e-26

Best Hits

KEGG orthology group: None (inferred from 91% identity to kko:Kkor_0838)

Predicted SEED Role

"tRNA-t(6)A37 methylthiotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>B158DRAFT_2271 MiaB-like tRNA modifying enzyme (Kangiella aquimarina DSM 16071)
MQVHLSALGCRLNEAELQNWANSFQRLGLSLTSEADAADLIVLNTCAVTAEAARKSRQTV
RRFHRANPQARKVVTGCYASLEPEEVAQIMGVDLVVANEDKDILVEKAKQLLEIPAMPEF
ATEPGESALFARNRERAFIKIQDGCRYRCTYCIVTVARGEEKSRTIQDLIDEINQLHAEG
VQEIVLAGVHVGGYGSDIDSSLYELVETILAETEMPRIRFASVEPWDLGENFFELFANPR
LMPHMHLPIQSGADTVLRRMSRRCKTSSFSELVRQARTQVPGFNVTTDVIVGFPGETDEE
FEQTMQYIEAVGFGHIHIFTYSDREGTKAARLPGKISKDVKKERSHRLHELAAKLKAKEL
EQQVGMTVPVLWESSNQYTEDGNQRYFGYTPNYHKVAVEIPSNLSPERLILNTRINGVDA
ENGFLNGVIIDEVPQRESPVIDVKTIA