Protein Info for B158DRAFT_2263 in Kangiella aquimarina DSM 16071

Annotation: tRNA (guanine-N1)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 TIGR00088: tRNA (guanine(37)-N(1))-methyltransferase" amino acids 1 to 239 (239 residues), 317.7 bits, see alignment E=1.8e-99 PF01746: tRNA_m1G_MT" amino acids 23 to 226 (204 residues), 208.6 bits, see alignment E=4e-66

Best Hits

Swiss-Prot: 60% identical to TRMD_IDILO: tRNA (guanine-N(1)-)-methyltransferase (trmD) from Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

KEGG orthology group: K00554, tRNA (guanine-N1-)-methyltransferase [EC: 2.1.1.31] (inferred from 92% identity to kko:Kkor_0830)

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>B158DRAFT_2263 tRNA (guanine-N1)-methyltransferase (Kangiella aquimarina DSM 16071)
MNIHVISLFPAMFDGVMEQGVVGRAVKQGKVNFAVTNPRDFTTDKHRTVDDRPYGGGPGM
LMMTQPLTEAIRYAETRMSLQEPSQPVYKIYLSPQGRRLNHQVVKELAEKPNLLLVAGRY
EGIDERIIESEIDDEISLGDFVLSGGEIAAMAVIDAVVRMQPGVLGHEDSAVEDSFAEGL
LDHPHYTRPEVFEGQQVPPILLSGDHDNIRRWRLKQSLGRTWLRRKDLLDAMQLNDEQQK
LLQEFIEEYEANLSK