Protein Info for B158DRAFT_2255 in Kangiella aquimarina DSM 16071

Annotation: Molecular chaperone (small heat shock protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF04969: CS" amino acids 39 to 126 (88 residues), 30.1 bits, see alignment E=1.2e-10 PF00011: HSP20" amino acids 42 to 140 (99 residues), 100.1 bits, see alignment E=1e-32 PF17886: ArsA_HSP20" amino acids 46 to 123 (78 residues), 31.2 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 34% identical to HSP16_SCHPO: Heat shock protein 16 (hsp16) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K13993, HSP20 family protein (inferred from 97% identity to kko:Kkor_0820)

Predicted SEED Role

"Molecular chaperone (small heat shock protein)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>B158DRAFT_2255 Molecular chaperone (small heat shock protein) (Kangiella aquimarina DSM 16071)
MQLSKWKPFSNIESFMNFPVSGLFDEMSNGFGNEWRPAVDFIEKSDEFLVKAELPEVKKE
DVKINIENNILSVQGERRYEEKDEKQHRLERFYGSFTRSFTLPDNVDTDQCKAEFKDGML
NIHLPKKAGSEKPKKSIQIN