Protein Info for B158DRAFT_2252 in Kangiella aquimarina DSM 16071

Annotation: sodium/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details amino acids 432 to 450 (19 residues), see Phobius details amino acids 457 to 475 (19 residues), see Phobius details amino acids 482 to 504 (23 residues), see Phobius details TIGR02121: sodium/proline symporter" amino acids 17 to 521 (505 residues), 648 bits, see alignment E=9.2e-199 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 44 to 465 (422 residues), 343.8 bits, see alignment E=1.5e-106 PF00474: SSF" amino acids 44 to 465 (422 residues), 362.9 bits, see alignment E=1.1e-112

Best Hits

KEGG orthology group: K11928, sodium/proline symporter (inferred from 92% identity to kko:Kkor_0817)

Predicted SEED Role

"Proline/sodium symporter PutP (TC 2.A.21.2.1) @ Propionate/sodium symporter" (TC 2.A.21.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>B158DRAFT_2252 sodium/proline symporter (Kangiella aquimarina DSM 16071)
MNYTKFDFLGMTVGPVEIAFMIYLVFMIAIGIWAYKRTNDSSDYMLGGRGLGGAVTALSA
GASDMSGWILMGLPGAIYFTGLSNSWLALFLIIGAYLNWKFIAGRLRAYTEIADNALTLP
DYFAGRFHDAGKALRIVAVLVMIVFFGYYIGSGLVAGSKLFESSFGYDYNTALLVSSIVI
ISYTFLGGFLAVSWTDFFQGLIIMTALIVAPIVLLVEYNGLSGIVEATREIKPEAVSFTQ
GFFDENNAFKWIGFLSLAAWGLGYFGQPHILARFMAVKSVNTVPQARRIGMSWMIICVLG
AVFIGFAGIAFFGGDFNAKAYVLLTAEDVAVLNTERGSEKVFLLLTQALFNPWLAGFLLA
AILAAVMSTIDSQLLAVSSSVTEDVYKPYMRPNASEKELVWVNRFVVILVAGIGITVAIF
ERDSVLDLVGQAWAGFGASFGPIIIFSLLWQRMTRHGALAGIVTGAVTVLVWDWLGNNTD
IAIFKLYEMLPGFILSSIAIVVVSKLTQVAETTYNQFDWYRNEFKKYKS