Protein Info for B158DRAFT_2243 in Kangiella aquimarina DSM 16071

Annotation: Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00497: SBP_bac_3" amino acids 44 to 263 (220 residues), 114.6 bits, see alignment E=7.5e-37 PF01464: SLT" amino acids 292 to 395 (104 residues), 67.3 bits, see alignment E=1.4e-22

Best Hits

Swiss-Prot: 48% identical to MLTF_COLP3: Membrane-bound lytic murein transglycosylase F (mltF) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: None (inferred from 89% identity to kko:Kkor_0809)

Predicted SEED Role

"Transglycosylase, Slt family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>B158DRAFT_2243 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein (Kangiella aquimarina DSM 16071)
MNQGLTIKLLGLALVIVSALFLTSCSEEPKNQLERVQQQGYIKVYTRISPTTMYVGEEGF
SGFEYDLVKLFADELGVRVQIVTENDIAKILREVSSGRADFAAAGLTVTQQREEFLRFGP
PYQEITSKLVYKQGNDRPRDFSQVDKNLTVVANSSHSEELLKAQKDYPNLSWTERSDLTP
QDLLDGVLDGTFDYTIVDSNELQLARQVQPELAVAFSITEPEPLAWAFPKDSDNSLYIKA
IEFFSKIRGDGTLAYLTERYYGHLSKFDYVGNREFLRAIEDKLDKYRPYFYEAAANDLDW
RLLAAMGYQESHWEPHARSPTGVRGLMMLTLNTAKQLGVKNRLDAEQSILGGADYLRLVK
EKIPDRIEEPDRTWFALAAYNVGYGHLEDARRLAEGDGANPDKWLDVKEYLPLLRQKKWY
SRTRYGYARGDEPVKYVNNIRMYYQVLKQVAEPKAGGSELVDPETESMQEDEDIGDHRQD
GENVVGTDEAIAETESDKPEDDTEK