Protein Info for B158DRAFT_2238 in Kangiella aquimarina DSM 16071

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 185 to 253 (69 residues), 58 bits, see alignment E=8.6e-20 PF21082: MS_channel_3rd" amino acids 331 to 397 (67 residues), 33.9 bits, see alignment E=3.5e-12

Best Hits

Swiss-Prot: 57% identical to YBDG_SHIFL: Miniconductance mechanosensitive channel YbdG (ybdG) from Shigella flexneri

KEGG orthology group: None (inferred from 84% identity to kko:Kkor_0804)

Predicted SEED Role

"Putative transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>B158DRAFT_2238 Small-conductance mechanosensitive channel (Kangiella aquimarina DSM 16071)
MQQKITEWLQNHGVEFSDMTALASVLGLIVLISVVVHLILHRVVLRFVENRARQSKKLWK
RSLFENKLFNRFALMIQGIIIYIQAGLWLMPESIVLNWIQTITLLWIQLFALLTIFSFLD
ALYLMGQKKTEAKALPLKGIFQSIKILAVLVVAILAISILAGKSPILILSGLGAMTAVVM
LVFKDPILGLVAGIQLSANDMLEVGDWLEMPQYGADGDVIEIGLTTVKVQNWDKTITTIP
TYALISNSFKNWRGMMESGGRRIKRSVLIDSSTVEFLTDEAIEKLSKSKLLAPYLQQKLD
EVKKYNEENGLDMSLRINGRRLTNLGTFRAYLLNYLKNHPQIHQELTLMVRQMEAAASGI
PLEIYAFTKTTDWAKYEGIQSDIFDHIFAVLPEFGLRVHQSPTGYDVRSLAFGREEGAYS
QPAIRAEAEQNKSC