Protein Info for B158DRAFT_2237 in Kangiella aquimarina DSM 16071

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1128 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details PF17159: MASE3" amino acids 41 to 271 (231 residues), 219 bits, see alignment E=3.3e-68 PF13185: GAF_2" amino acids 425 to 561 (137 residues), 93.5 bits, see alignment E=7.1e-30 PF01590: GAF" amino acids 475 to 559 (85 residues), 26.4 bits, see alignment 4.6e-09 PF00989: PAS" amino acids 572 to 676 (105 residues), 59.8 bits, see alignment E=1.3e-19 TIGR00229: PAS domain S-box protein" amino acids 572 to 691 (120 residues), 65.4 bits, see alignment E=5.3e-22 PF08448: PAS_4" amino acids 578 to 683 (106 residues), 43.3 bits, see alignment E=2e-14 PF13426: PAS_9" amino acids 582 to 683 (102 residues), 53.4 bits, see alignment E=1.4e-17 PF08447: PAS_3" amino acids 595 to 676 (82 residues), 35 bits, see alignment 7.3e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 694 to 854 (161 residues), 133.8 bits, see alignment E=4.9e-43 PF00990: GGDEF" amino acids 697 to 851 (155 residues), 140.4 bits, see alignment E=2.3e-44 PF00563: EAL" amino acids 873 to 1107 (235 residues), 256.2 bits, see alignment E=1.4e-79

Best Hits

KEGG orthology group: None (inferred from 78% identity to kko:Kkor_0803)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1128 amino acids)

>B158DRAFT_2237 PAS domain S-box/diguanylate cyclase (GGDEF) domain (Kangiella aquimarina DSM 16071)
MLTKLRSLQSSDRSVSAWVITLVISMGIVLVLPEPELSRGLASYLPLHTTLEIIAIAVAC
MVFGIAWVTQKFQPSSKVIILGTGALSVLLLDITHTISYQGMPSFITPSGPEKAINFWLA
ARFMMAMTLLFVACINYRVEQKLTKISRYFWLSLALVIVALFHIWFLYFPQSVPATFNQG
EGLTSFKVIAEYVLIGIYLLSGFLLITQLSHVREFGVNWLVAAAVTMAMSEFFFTMYANV
SDMYNLIGHVYKVIAFSFLYRALFVETVQSPFLNMLQLQAKLTATIDTLPDILVEVDSKG
NHVEIHSSDPKLLIDKPENLVGKNIKQVMSKEAARTCFEAMEVADKIGISRGARIKLNTQ
SGEHTFELSIARKVSQASKHPTFLILSRDISSTIEFEQQIAHEAKLNKHLLELQNHLHVG
GEKHFMQHSVDTAENLTDSSIAFIHFIDETQKIIKIVTWSTNTLTHHCTANFESHYPIDQ
AGVWADAIRTKRPVVINDYQDSSAKKDLPEGHAYLKRFISLPVIENNKVTMMVGVGNKES
DYNHQDVETLQILANTIWNLIKQRWQDTTIRRLSTGIDQNPYPVLITDTDGKIQYVNRAF
TETTGFSEQDAIGKSPIDFSAENDPDKTFKAIWRQLARGEAWRGELISQRQDGSQYTEFA
MIYPVRNEQGKIINYVAHKEDITLKKIAEEKIHQLSNYDQLTGLLKREMLEERLQQLLDD
SFKQKQAMTVIWLDLDNFKTINDSLGHQVGDLILIEIANRLRFELGKQSIISRIAGDTFA
AVLPATNEHSAAIIAKKLLENIQRKIKFSSHALSVSTSIGLALSPNDGNSSAKLMMRAEA
AMYRAKQDGRNSFRFFAQEMQEHSLRSLQLSAALKDALINDQFHLVYQPQLNLTDNTIVG
AEALLRWDHPEWGAISPAEFIPLAEQNGLIVKIGEWVLQQVARQQKQWLSKDLPEIIVAI
NISALQFHQQNLVERISKIVEEAGVSPDNIEIELTEAVALKDPEVAGKTIDALSQQGFKV
SIDDFGTGYSSMSYLKRFAVHKLKIDQSFIKDIVTDIDDQAIVTAIIQMAHSLHKTTIAE
GVETQEQIEFLKLKGCEEIQGYWYSRPLVTEQFEAFLLASNSKTTKIN