Protein Info for B158DRAFT_2236 in Kangiella aquimarina DSM 16071

Annotation: [SSU ribosomal protein S18P]-alanine acetyltransferase (EC 2.3.1.128)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01575: ribosomal-protein-alanine acetyltransferase
  • amino acids 17 to 148 (132 residues), 118.4 bits, E=1.2e-38
• PF00583: Acetyltransf_1
  • amino acids 21 to 126 (106 residues), 65 bits, E=1.5e-21
• PF13673: Acetyltransf_10
  • amino acids 35 to 130 (96 residues), 47 bits, E=5.1e-16
• PF13508: Acetyltransf_7
  • amino acids 49 to 128 (80 residues), 45.9 bits, E=1.3e-15
• PF08445: FR47
  • amino acids 70 to 129 (60 residues), 24.5 bits, E=4.5e-09

Best Hits

Swiss-Prot: 37% identical to RIMI_SHIFL: [Ribosomal protein S18]-alanine N-acetyltransferase (rimI) from Shigella flexneri

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 77% identity to kko:Kkor_0802)

MetaCyc: 37% identical to protein N-acetyltransferase RimI (Escherichia coli K-12 substr. MG1655)
2.3.1.128-RXN [EC: 2.3.1.266]; 2.3.1.- [EC: 2.3.1.266]

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128 or 2.3.1.266

Protein Sequence (152 amino acids)

>B158DRAFT_2236 [SSU ribosomal protein S18P]-alanine acetyltransferase (EC 2.3.1.128) (Kangiella aquimarina DSM 16071)
MFYPDNDYHVRPLTGADLEQVCAIENRAYKLPWSDKIHAQCIESGYPSLVLEQGGAIIGY
AIFNYLYDECHLMNIVTDPGFQGLGVASLLISAMYERAKESGMVKVILEVRASNQIAIDF
YHKQEFVEIGLRKDYYKTADGREDALVMERVL