Protein Info for B158DRAFT_2226 in Kangiella aquimarina DSM 16071

Annotation: Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 303 to 329 (27 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details amino acids 414 to 440 (27 residues), see Phobius details amino acids 462 to 485 (24 residues), see Phobius details amino acids 706 to 727 (22 residues), see Phobius details amino acids 759 to 782 (24 residues), see Phobius details amino acids 795 to 816 (22 residues), see Phobius details PF02687: FtsX" amino acids 257 to 375 (119 residues), 43.1 bits, see alignment E=4e-15 amino acids 710 to 823 (114 residues), 43.7 bits, see alignment E=2.5e-15

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 93% identity to kko:Kkor_0792)

Predicted SEED Role

"ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (831 amino acids)

>B158DRAFT_2226 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component (Kangiella aquimarina DSM 16071)
MRGMAWRLFKRDWQSGEVKVLFFALMIAVMAMVAIGTITDRTHRAMGEQSSEFLGADYTL
RSPRPIEHDWLEKGRSDGLELTESTGFSTVLAKGDEFQLVSVTALGGKFPLKGEFEIADK
PFTRGQTMQAQPEQGTAWVEPRVLAVLGAEKGDTVDFGSIQLTIAGVIVGGPGQASEMFN
VAPKVYINQADVERANIIQPGSRVSYTLFIAGDIQSRENFIDWVKPQMNKTQRLTGGKEG
TPALQASIERAETFLRLASLISVVLAGVAIAVAAGRFSRRHYDYAAIYRCLGMQIAQVHR
LYLSQLIIMGLIGSALGVALGLLIQQVIIVQFADFLPKPMVPINWAPVIAGGLSGLVVLI
GFALPAFFQIARVSPLRVLRKEMVPQPVSSWLIYLLAIFTMALLMWWQSGSLKLVGILLA
VALVAFVIIRLMAWLIFKVGLWIGKRGSTAVRYGLGQLKRYPAFTISQVTAFGLAFIIML
STVLIRSELLNEWQSQLPEDAPNHFLINVQPSEVPNLESILAEQNVETAGIYPMVRGRVT
GLNGKPIEEAVSEEAQNDGSLRRELNLTWVENVPNANTVVKGEWWNDAGQPDEDGVYQLS
IDQNLAGRLGVDIGDVFEFSIGGVDVEGKITSFREIQWDSFQPNFFMIFEPGALNENMAT
YITSFYLPAEKKPTLNTILREMPTVTIIELDAIMEQVQTILDQVTAAVEFIMLFVLLAGI
AVLYAVLQASKEERVLSSTLLKTLGAQTKFIRMTLLSELALLGIFSGILGVIGGEVLVFV
LYQEALDIEPVLHPWFWLWVPLIAVAFICLAGWWGLKSLLKQPAHQVLRQL