Protein Info for B158DRAFT_2225 in Kangiella aquimarina DSM 16071

Annotation: Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 167 (147 residues), 128.5 bits, E=3e-41

Best Hits

Swiss-Prot: 55% identical to YBBA_ECO57: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Escherichia coli O157:H7

KEGG orthology group: K02003, (no description) (inferred from 91% identity to kko:Kkor_0791)

MetaCyc: 47% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

No annotation

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Protein Sequence (235 amino acids)

>B158DRAFT_2225 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component (Kangiella aquimarina DSM 16071)
MLTTNNLTKTVKLPEQSLTILSEVSLTVNEHDSVAIVGASGSGKSTLLSLLAGLDTPSEG
EVELAGHPIHKLSEDERAAVRAQYVGFVFQSFHLLPGLTALENVMLPIELKEDKNAQTKA
KELLEKVGLAERLNHYPHQLSGGEQQRVAIARAFASEPKILFADEPTGNLDTANGEKIID
LIFDLNQQLGTTLVLVTHDDRLAERCQRLVRLEAGKVIEDSVNESFEQAKTAETA