Protein Info for B158DRAFT_2217 in Kangiella aquimarina DSM 16071

Annotation: TonB family C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details PF05569: Peptidase_M56" amino acids 14 to 278 (265 residues), 153.3 bits, see alignment E=8.5e-49 PF03544: TonB_C" amino acids 603 to 675 (73 residues), 54 bits, see alignment E=1.9e-18 TIGR01352: TonB family C-terminal domain" amino acids 604 to 674 (71 residues), 38.4 bits, see alignment E=6e-14

Best Hits

KEGG orthology group: None (inferred from 89% identity to kko:Kkor_0784)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (676 amino acids)

>B158DRAFT_2217 TonB family C-terminal domain (Kangiella aquimarina DSM 16071)
MLSDLKMNGWLDAFWHFNLDLSVIVLSVLIVRFFIRKTTKSYNSYLLWLAIPLGFVVAKI
IASIDFSSANSAYIGQAVSVMIAKPVETLQNYWWLGALWLTGTTLLLLRLIIQHIELRKD
LRKIEKPISELPGFNLIRKSRYQVIAVDHKDMSPAVYGFIKPTIYFPIHVAKQLSVQQIQ
LIIEHEEQHIKQKHLWLNLLWDVLVCIGWFNPLIYIARKNFRHDQELFCDYLVLNKGNQT
RTKDYGHALLSTVSATHSVSLLCSWKVFNQLEERIMNITDPLNKTGKIVMTLGAAFVLSC
CAVYAANKEPKEERVITTENIVIDDEGNKKVVLEFSEGDGITYLQENDNYYILEGDNKRP
MTDKERMEFEQKHEEAQKRVYMTEQELMLVEEELENAHRVLVLHEDELQEVEIDIDNAHK
ALAEAQREIEIDYQKGNISKEEMEQAREAILKAKEEMSSGKMKKRIRVDMERARADMEKA
RADIEKQRHEIIIRREPADSTSGPHRVFIVDDEAIINGENKQTRVIKWEEDSGKVYSVEN
GKYMVLENGTKREMTEEEKALFENKVRMIPKPDMPRIPPQPVEPKQPTSALKAKDVTPTS
TTPPEYPAYAAKNKIDGYVLFKFDVDGKGKAYNIRVTKSEPEGVFEKAATKAIEQWEFAK
DKQVSDVSYKIDFRLE