Protein Info for B158DRAFT_2215 in Kangiella aquimarina DSM 16071

Annotation: Na+/H+-dicarboxylate symporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 62 to 64 (3 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 234 to 260 (27 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details PF00375: SDF" amino acids 3 to 415 (413 residues), 425.9 bits, see alignment E=8.1e-132

Best Hits

KEGG orthology group: None (inferred from 96% identity to kko:Kkor_0782)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>B158DRAFT_2215 Na+/H+-dicarboxylate symporters (Kangiella aquimarina DSM 16071)
MNLSLKILIYMVAGAIVGVLFLQFGDYQCAKGITKEACSAIQEDSWAYTYFVNGIFEVGG
SWFINALKMLMVPLVLVSLVCGVSSLADPSKLGKLSLKSIGLYLLTTSIALIGALTLASI
FKPGVGMPVGDATFDASDKPPLTKVLIDIIPTNPFEAMVAANMLQIIVFAILIGLAITMS
GEKGKRIGNWFNDVNKVVMELVNIIMRFAPYGVFFLIAKTFATFPFSDLAGSLGYYFLLV
IGALILHALVTYGALIALLARLNPVNFFKGMWPAMLTAFGTSSSNATLPVTMRCAEKNLG
VHRNTYSFTLPLGATINMDGTAIMQGIATLFIAQAYSVDLSMAQLLTVVLTATLASIGTA
GVPSVGLILLAGVLTQVNLPVEAIGMILGIDRLLDMTRTAVNITGDAAVSVIVAKSENEL
DKDVYDHEKVHTEFDD