Protein Info for B158DRAFT_2208 in Kangiella aquimarina DSM 16071

Annotation: transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 TIGR02812: fatty acid metabolism transcriptional regulator FadR" amino acids 6 to 233 (228 residues), 319.5 bits, see alignment E=7.1e-100 PF00392: GntR" amino acids 12 to 73 (62 residues), 72.8 bits, see alignment E=2.1e-24 PF07840: FadR_C" amino acids 74 to 234 (161 residues), 181 bits, see alignment E=2.5e-57 PF07729: FCD" amino acids 102 to 215 (114 residues), 42 bits, see alignment E=1.8e-14

Best Hits

Swiss-Prot: 54% identical to FADR_PROMH: Fatty acid metabolism regulator protein (fadR) from Proteus mirabilis (strain HI4320)

KEGG orthology group: K03603, GntR family transcriptional regulator, negative regulator for fad regulon and positive regulator of fabA (inferred from 96% identity to kko:Kkor_0776)

Predicted SEED Role

"Transcriptional regulator for fatty acid degradation FadR, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>B158DRAFT_2208 transcriptional regulator, GntR family (Kangiella aquimarina DSM 16071)
MVSTAKALTPAAFAEQYIVESIWNGKFAAGTILPAERELAEIIGVTRTTLREVLQRLARD
GWLTIQHGKPTKVNDIWQSATLNVLDTLITLDDEGSMKLADDLLQARTSIASIFLRQAVK
NNPEKLLEVLKELDGVNNDADGYIDFDWHFHHTATRASGNPIYTLMLNGFEAIYYKLGRF
YFGWEQTRKLAYQYYKDLEVAIGKGDAEQVVKILWDYGHESGELWNKAKSELKSFSELGA