Protein Info for B158DRAFT_2202 in Kangiella aquimarina DSM 16071

Annotation: multisubunit sodium/proton antiporter, MrpD subunit (TC 2.A.63.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details amino acids 307 to 331 (25 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details amino acids 457 to 476 (20 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 131 to 423 (293 residues), 204.5 bits, see alignment E=1.1e-64

Best Hits

KEGG orthology group: K05568, multicomponent Na+:H+ antiporter subunit D (inferred from 91% identity to kko:Kkor_0770)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>B158DRAFT_2202 multisubunit sodium/proton antiporter, MrpD subunit (TC 2.A.63.1) (Kangiella aquimarina DSM 16071)
MIDQNVLMQLIIILPLLAIPGIIAFGKWANLREAVTLIAGGLLLVAVIIFYQGFDSGQTA
YVKWLELLPGLDISFRAEPLGVLFSLVAGSLWVVTSIYAIGYMRGHGEVNQTRFYACFAV
AISAVMGLAFADNLFTLFVFYEVLTLSTYPLVTHAGTDKAKQGGRTYLSILLATSIGFLL
LAVVGTWWQAGTLTFTEGGVFDENTSIVAASVLLVLFIFGIGKAAIMPFHRWLPAAMVAP
TPVSALLHAVAVVKAGVFTVLKVCVYIFGIDLLRDIPATQWLLYLAAASVLLASLVAMRQ
DNLKKRLAYSTVSQLGYITIGALLASQAGILGGALHIVAHAFGKITLFFCAGAIMVAAHK
TEISDMRGLGKAMPITMIAFFIGSLSIIGLPPAAGVWSKWYLLMGTLDTHQWVVMSVLML
SSLLNIAYLLPIPLRAFFPGTGQVVKVERSAIKEAPLPSLIALSITALMTMILFFWPDIF
YELAASLAGLSGGVNG