Protein Info for B158DRAFT_2201 in Kangiella aquimarina DSM 16071

Annotation: multisubunit sodium/proton antiporter, MrpD subunit (TC 2.A.63.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 242 to 268 (27 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details amino acids 451 to 471 (21 residues), see Phobius details PF10125: NADHdeh_related" amino acids 117 to 220 (104 residues), 33.3 bits, see alignment E=3.5e-12 PF00361: Proton_antipo_M" amino acids 131 to 424 (294 residues), 214.9 bits, see alignment E=1.5e-67

Best Hits

Swiss-Prot: 30% identical to MRPD_BACPE: Na(+)/H(+) antiporter subunit D (mrpD) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K05568, multicomponent Na+:H+ antiporter subunit D (inferred from 92% identity to kko:Kkor_0769)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain N (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>B158DRAFT_2201 multisubunit sodium/proton antiporter, MrpD subunit (TC 2.A.63.1) (Kangiella aquimarina DSM 16071)
MIDHLPILQVIVPLLAAPICLILREAQLVRWFTLIASVFAFVISVLLLQQVQAHGTLIYS
LGGWDAPIGIEYRIDQLNAYLLILVTSISSVALLAAGTSLQKELTERKETYFYVAYLLCL
AGLLGILTTGDAFNVFVFLEISSLASYTLIAMGRDRRSLWASYQYLIMGTIGATFILIGI
GMMYMMTGTLNMYDLAERLPEVQQTKTVFTAFAFFMVGVCLKLALFPLHLWLPNAYAYAP
SIATVFLAATATKVAIYVLLRFIFSVYGFEFSFSHLPLKEILVALGLMGIFAASIVAIYQ
NNIKRLFAYSSVAQIGYMILGLGIGSKTGLVATLLHLFNHALMKGAIFLALAGVVYRVGS
VNIKAFAGLGKQMPWTMGAIVVGGLSLIGVPLTVGFVSKWYLVLALLESNWWPIAILVLV
GSLLAVIYVWRLVEAAYFRPALQDSAPYKEAPLMILIPTWILVLANIYFGIDTSFTVGLS
EQISASLFGVAK