Protein Info for B158DRAFT_2200 in Kangiella aquimarina DSM 16071

Annotation: multisubunit sodium/proton antiporter, MrpC subunit (TC 2.A.63.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 33 to 55 (23 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details PF00420: Oxidored_q2" amino acids 10 to 110 (101 residues), 71.7 bits, see alignment E=1.7e-24

Best Hits

KEGG orthology group: K05567, multicomponent Na+:H+ antiporter subunit C (inferred from 93% identity to kko:Kkor_0768)

Predicted SEED Role

"PH adaptation potassium efflux system protein C; sodium- potassium/hydrogen antiporter subunit C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>B158DRAFT_2200 multisubunit sodium/proton antiporter, MrpC subunit (TC 2.A.63.1) (Kangiella aquimarina DSM 16071)
MNFLEQYNYWIVIVLMMSGFYIVIAHGNLIKKLIGLTVFQTSVFIMYISMSKVIGGTAPI
LNEAYKVYSNPLPHVLILTAIVVGVATTSLGLALAVRIKEAYGSVEEDVIQEKDLQQEGS
QE