Protein Info for B158DRAFT_2198 in Kangiella aquimarina DSM 16071

Annotation: multisubunit sodium/proton antiporter, MrpG subunit (TC 2.A.63.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 12 to 99 (88 residues), 98 bits, see alignment E=1.5e-32 PF03334: PhaG_MnhG_YufB" amino acids 12 to 91 (80 residues), 98.5 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: K05571, multicomponent Na+:H+ antiporter subunit G (inferred from 80% identity to kko:Kkor_0766)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>B158DRAFT_2198 multisubunit sodium/proton antiporter, MrpG subunit (TC 2.A.63.1) (Kangiella aquimarina DSM 16071)
MAIFLDAVSWALLVLGGFMCFSGAVGIHRFPDFFSRMHAAGVTDTLGSSLILIGLMLQTG
WQDTVLVKLLLIFLFILLTSPTASHALAKAALHGGLRPKLGKPEVSDDIPEKFGKPSSES
TNN