Protein Info for B158DRAFT_2183 in Kangiella aquimarina DSM 16071

Annotation: periplasmic serine protease, Do/DeqQ family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR02037: peptidase Do" amino acids 60 to 423 (364 residues), 426.3 bits, see alignment E=7.2e-132 PF13365: Trypsin_2" amino acids 63 to 198 (136 residues), 121.3 bits, see alignment E=2e-38 PF00089: Trypsin" amino acids 63 to 218 (156 residues), 73.1 bits, see alignment E=1.1e-23 PF00595: PDZ" amino acids 234 to 314 (81 residues), 38.7 bits, see alignment E=3.8e-13 amino acids 338 to 418 (81 residues), 39.8 bits, see alignment E=1.7e-13 PF13180: PDZ_2" amino acids 236 to 324 (89 residues), 51.8 bits, see alignment E=3e-17 amino acids 344 to 426 (83 residues), 45.9 bits, see alignment E=2.1e-15 PF17820: PDZ_6" amino acids 263 to 316 (54 residues), 39 bits, see alignment 2e-13 amino acids 366 to 420 (55 residues), 39.6 bits, see alignment 1.3e-13

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 81% identity to kko:Kkor_0751)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>B158DRAFT_2183 periplasmic serine protease, Do/DeqQ family (Kangiella aquimarina DSM 16071)
MMLKRFYSTGLIVLFFILGSAFSPPAKSSYPDFTELVEKVQPSIVSIQVDVVRWGRVAGR
AGGSGFIIDDEGYILTNHHVIDNGDTVTVKLYNGREFKAEVIGSDANTDVALLKIEPGKQ
DLKALKLGTSDVLKVGEWVLAFGAPFNLEQTVTAGIVSAKGRGEVGSQYVPFIQTDVAIN
RGNSGGPLVNLEGEVVGINSMVFNPMISSGLSFSIPIDLANNIREQLLESGVVNRGYLGV
MFSSIDQDRADAFGLKEVSGSLVRRILPGSAAEAAGLQEGDVVIAVDGKPVRKAQDLPYY
VGQKMPGDTVKLDVIRNGKEIEIDAVLTDSSGRTASINGGQDKLGIRVQALRDDLQEAYG
IRQGVVVSDVAEQSPAAQAGIQNGDIIQKLHQTPIRTLEDYQRALASLPEKGKVALLVAR
PGRGSDFFVIKLD