Protein Info for B158DRAFT_2181 in Kangiella aquimarina DSM 16071

Annotation: Negative regulator of sigma E activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 109 to 127 (19 residues), see Phobius details PF03872: RseA_N" amino acids 17 to 96 (80 residues), 57.4 bits, see alignment E=8.7e-20

Best Hits

KEGG orthology group: K03597, sigma-E factor negative regulatory protein RseA (inferred from 63% identity to kko:Kkor_0748)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>B158DRAFT_2181 Negative regulator of sigma E activity (Kangiella aquimarina DSM 16071)
MLDNKDLDKGLVGRFDKQNVSAWVDNEKAGNELEAFASEDSFAIESEEMQLWSRYHLIGQ
VMRDEVKHLDLDIAARVNSEIANEPEHSVEVNQPKSNVISFPSNPFKQIAGYAIAASVAL
VVLFNVGNQNTLDSQVNPMATVASNDATPTAASSSTSLSRVERQELQTIHDMFLKHESLS
QSSLLPSVQVVSNQKVIPVSVPLMTEQSETQQPTPLKVEQEQAENQ