Protein Info for B158DRAFT_2164 in Kangiella aquimarina DSM 16071

Annotation: amino acid/peptide transporter (Peptide:H+ symporter), bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 735 transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 89 to 106 (18 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details amino acids 413 to 431 (19 residues), see Phobius details amino acids 452 to 476 (25 residues), see Phobius details amino acids 483 to 504 (22 residues), see Phobius details amino acids 515 to 531 (17 residues), see Phobius details amino acids 560 to 583 (24 residues), see Phobius details amino acids 595 to 613 (19 residues), see Phobius details amino acids 619 to 641 (23 residues), see Phobius details amino acids 652 to 671 (20 residues), see Phobius details amino acids 709 to 727 (19 residues), see Phobius details PF00854: PTR2" amino acids 338 to 686 (349 residues), 213.9 bits, see alignment E=3.6e-67 TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 343 to 731 (389 residues), 270.8 bits, see alignment E=1.3e-84 PF07690: MFS_1" amino acids 346 to 676 (331 residues), 34 bits, see alignment E=1.6e-12

Best Hits

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (735 amino acids)

>B158DRAFT_2164 amino acid/peptide transporter (Peptide:H+ symporter), bacterial (Kangiella aquimarina DSM 16071)
MTAETNTIPKDEKTILGHPRGLIILFFTEMWERFSYYGMRGLLIIYLTQHFLFSDEKSTI
LYGAYTALVYVMTIIGGSLADRYLGTRKAVTFGAILLVLGHIGMAFEGSGSKELMSHSGK
EYQITLDGRGGDARQILKTEQGQTYINFGNQTLQINNATALGLPSELGGFEYEVKNGDEE
LQQENKTVKTLTYNGQDYQLVEEGEGDKKVVTLEKDGISGTVNFSENRAMTFGVNPTLYL
STSFKLGPSFPNKIDGFDYTVVSQQVEGGTETRQIQYQNKNYTLIKTGTGEDATYVLKGQ
EGESEVSIEAPADIKISSHESLNLPAVIEGDEYQTKIVKQDLYVNILYLSLALIIAGVGF
LKANISTIVGSLYGFGDTRRDSGFTLFYMGINLGSLLSSLTCGIIGIVWGWAYGFGLAGI
GMILGLVTFIWKQDWLEGKAEPPNPAKLKEKAFAFINYEWMCYLIGVGIIAISMFFVMNA
EIMGDIFGVLGIVMLAILISYAVIKLKGDERHRMFAAIYFILAQIPFWALFEQAGSSLNL
FTDRLVDRSMMGWVVPAPVFQSLNAAYIIIFAPILAWLWSFLAKRKLNPPTPVKFALGVF
LCGFGFLALVGGIEASTEVGLTAVYFIFLIYLLHTLGELMVSPVGLSAVTKLAPAQAVGM
TMGAWFLYSGLSNFLAGVIAKTTGAETIGGQLTDVAAAKATYVDVYTNVSYWAMGIAVFM
LLISPLIKKLMEGAD