Protein Info for B158DRAFT_2162 in Kangiella aquimarina DSM 16071

Annotation: phosphoadenosine phosphosulfate reductase, thioredoxin dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02057: phosphoadenosine phosphosulfate reductase
  • amino acids 10 to 230 (221 residues), 273.3 bits, E=1.9e-85
• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 22 to 230 (209 residues), 262 bits, E=4.6e-82
• PF01507: PAPS_reduct
  • amino acids 36 to 208 (173 residues), 194.4 bits, E=8.6e-62

Best Hits

Swiss-Prot: 62% identical to CYSH_PROMH: Phosphoadenosine phosphosulfate reductase (cysH) from Proteus mirabilis (strain HI4320)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 74% identity to kko:Kkor_0728)

MetaCyc: 58% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Protein Sequence (237 amino acids)

>B158DRAFT_2162 phosphoadenosine phosphosulfate reductase, thioredoxin dependent (Kangiella aquimarina DSM 16071)
MRLPNADWLMQVNQALKTRTASERIEYTLEHCPGKAVVASSFGAQSAVSLHLLTRIMPSI
PVILIDTGYLFTETYQFIDKLHDRLKLNLKVYRSELSPAWQEARYGKRWQQGISGIEAYN
QLNKVEPMERALRDLDVGTWFSGLRRQQAKSRQKLPIVQAFKGRIKVHPIIDWSNKDVHE
YLKEYDLPYHPLWNKGYVSIGDTHSTKPLGSDMDEEDTRFGGLVRECGLHVDTLSGL