Protein Info for B158DRAFT_2158 in Kangiella aquimarina DSM 16071

Annotation: Predicted SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18125: RlmM_FDX
  • amino acids 6 to 73 (68 residues), 84.1 bits, E=1.2e-27
• PF21239: RLMM_N
  • amino acids 86 to 161 (76 residues), 67 bits, E=1.9e-22
• PF01728: FtsJ
  • amino acids 184 to 281 (98 residues), 47 bits, E=4.6e-16

Best Hits

Swiss-Prot: 48% identical to RLMM_PASMU: Ribosomal RNA large subunit methyltransferase M (rlmM) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K06968, ribosomal RNA large subunit methyltransferase M [EC: 2.1.1.-] (inferred from 94% identity to kko:Kkor_0724)

Predicted SEED Role

"LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (358 amino acids)

>B158DRAFT_2158 Predicted SAM-dependent methyltransferase (Kangiella aquimarina DSM 16071)
MNQTPFVFYCRPGFESDCAAEVQSFANACDLAGYANTAPNSGYVRFFLFDEASEQVFFEE
LDIHELIFARQWFWAKAELVELPLDDRITPILEVCSEVAMAKQVLVEHLDSDEGRELSKF
CKKFSTPVTITLEKQGLIHEDSEFQLHLLFLATDHCLVGFSPVGRASELKGGILRLKFPK
DAPSRSTLKLEEAIQTLMSGKQRKAVLRLGHTAVDLGAAPGGWTYQLVQHGLQVTAIDNG
SMDKKLMQTEHVIHLKENALAWMPEKPVNMLVCDMVEKPSLVAKLMAKWLVAGKTEHAIF
NLKLPMKKRFQEVNDCIGMICDELEEADIDYFWQAKHLYHDREEITVYFRRKIKNQSH