Protein Info for B158DRAFT_2155 in Kangiella aquimarina DSM 16071

Annotation: HhH-GPD superfamily base excision DNA repair protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00730: HhH-GPD" amino acids 51 to 195 (145 residues), 59.4 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: K01247, DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 41% identity to pbs:Plabr_1882)

Predicted SEED Role

"DNA-3-methyladenine glycosylase II (EC 3.2.2.21)" in subsystem DNA Repair Base Excision (EC 3.2.2.21)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>B158DRAFT_2155 HhH-GPD superfamily base excision DNA repair protein. (Kangiella aquimarina DSM 16071)
MKANNQLALNQRLREAEDLLAKADSKMASLIQRHGPCQIQPSSRPPFEYLIRSIISQQLS
TKAASTIVSRVENLLGEQGFSARAILGVTYEQLRACGLSNAKVQYSQGIAQACLEVSLDF
NALADMPSEEVIESLVQLKGVGEWTAQMFCIFALGHLDVFAPADIGLQRGLQHLYELEEK
PAKPLMLELTEPWRPYRSVASWYLWRIADEI