Protein Info for B158DRAFT_2148 in Kangiella aquimarina DSM 16071

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF00892: EamA" amino acids 10 to 145 (136 residues), 88.8 bits, see alignment E=1.8e-29 amino acids 163 to 300 (138 residues), 56.1 bits, see alignment E=2.2e-19

Best Hits

Swiss-Prot: 40% identical to Y878_HAEIN: Uncharacterized transporter HI_0878 (HI_0878) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 94% identity to kko:Kkor_0715)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>B158DRAFT_2148 Predicted permeases (Kangiella aquimarina DSM 16071)
MHTVSGRWQLGLLLSLTTALLWGLLPIALKTLLDQMDAVTVTWYRFFSAAAILFIFLIYK
RKSPNIKLLKGNILWLMIISVVGLSLNYVFYLFGVNLITPSSAQVMIQTAPMFMLLGGLL
IFKESFNKQQWFGFACFVIGLILFFNLRFEEIFEQITGDYAVGLGWMFLAAIVWAAYALA
QKQLLNNYRSDQVMFMIYLACVPLLSPWSSPGQALELDTLGWWLLIFCCLNTLIAYGAFA
EALAHWEASRVSAILAITPLVTIGSMKILEYFYPETLLSEPINIFSIAGALLVVTGSMIT
ALSGRKVVPVAE