Protein Info for B158DRAFT_2145 in Kangiella aquimarina DSM 16071

Annotation: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF00364: Biotin_lipoyl" amino acids 5 to 77 (73 residues), 71.1 bits, see alignment E=2e-23 amino acids 132 to 202 (71 residues), 64.3 bits, see alignment E=2.6e-21 TIGR01348: dihydrolipoyllysine-residue acetyltransferase" amino acids 104 to 552 (449 residues), 602.1 bits, see alignment E=5.7e-185 PF02817: E3_binding" amino acids 254 to 289 (36 residues), 57.9 bits, see alignment 3.4e-19 PF00198: 2-oxoacid_dh" amino acids 323 to 551 (229 residues), 263.5 bits, see alignment E=5.4e-82

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 85% identity to kko:Kkor_0713)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.12

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>B158DRAFT_2145 pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form (Kangiella aquimarina DSM 16071)
MADITQVKVPDIGDASGVDVIEVLVNVGDTIDVEDSLIVLETDKATMEVPSSHAGVVKSI
DVKVGDKVSEGDVILSIEATENTSAADNSEESNEEAAEEVTEADTQQEQQSADASEQDED
DSDGAEEKEEPLIVPDIGDASDVDVIEVTVKAGDSVEKDDSLFVLETEKATMEVPSPSAG
TIVSMSVKVGDKVSQGDQIGVIKTAATKSTKPKKQQQPADEPKPTQEAPKQADTPKPAPV
SDYPVQAPTEGKLVHASPAVRRLAREFGADLTKVKGTGPKSRIMKEDVQSYIKFELSRPK
ATASSGAVGTPDLPEIDFSKFGEVEQKPLSRIQKISSVNLHRNWTMIPHVTQHEDADITD
LDAFRKSMKEEAAKEGVRLTPLAFIMKALVASLKAFPTFNASLANDGENLILKKYYNIGV
AVDTPDGLVVPVIRDVDKKSVYELAKELGEVSEKARDKKLGAADMQGSCFTISSLGGIGG
TSFTPIVNWPDVAILGLSRNQMKPVWNGKEFEPRMMLPMSLSYDHRVIDGAVAARFIVHL
SKMLGDIRRVIL