Protein Info for B158DRAFT_2143 in Kangiella aquimarina DSM 16071

Annotation: Membrane protein required for beta-lactamase induction

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 52 to 71 (20 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details PF17113: AmpE" amino acids 1 to 211 (211 residues), 27.3 bits, see alignment E=2.3e-10 PF03186: CobD_Cbib" amino acids 31 to 215 (185 residues), 42.4 bits, see alignment E=5.5e-15

Best Hits

KEGG orthology group: K03807, AmpE protein (inferred from 86% identity to kko:Kkor_0711)

Predicted SEED Role

"AmpE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>B158DRAFT_2143 Membrane protein required for beta-lactamase induction (Kangiella aquimarina DSM 16071)
MALLSLIIALLFERYFHTGSSEEREKFSNAGWFVSYQKRLASSFGEQSWFKGWLAEAILI
LLPVLLIFLLFESLEDGFLSSLFSVALAVVILVHCLGPESPRKSLRGYFSDIANDDEQGA
YEHAAKFAGKEADDWEQTQRMVSEAIFTETQRRYAAVVIWFVLLGPAGALLYRLLDWYLA
NNPEGSLSAPLKTVMDWVAGRVSALAYLLAGDMASGVSRIKKQFFNLNVGGMELIEATGV
AAIGPILDCETQQKQKVAENLCALKLTERTGVILFAFVAVMSLLGWTFF