Protein Info for B158DRAFT_2141 in Kangiella aquimarina DSM 16071

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00152: dephospho-CoA kinase
  • amino acids 5 to 185 (181 residues), 198.1 bits, E=6.1e-63
• PF01121: CoaE
  • amino acids 5 to 179 (175 residues), 213.7 bits, E=8.7e-68

Best Hits

Swiss-Prot: 49% identical to COAE_SHEON: Dephospho-CoA kinase (coaE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 82% identity to kko:Kkor_0709)

MetaCyc: 48% identical to dephospho-CoA kinase (Escherichia coli K-12 substr. MG1655)
Dephospho-CoA kinase. [EC: 2.7.1.24]

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Protein Sequence (199 amino acids)

>B158DRAFT_2141 dephospho-CoA kinase (Kangiella aquimarina DSM 16071)
MTYKVALTGGIASGKTAVSDMFAEQGVTVIDADVIAREVVAKGSQALQALTEHFGRDVLT
AQGELDRKKLRNKVFSNEQDRMWLNNLLHPLIRQEMKRRQELADSVYSISVIPLLYESGQ
CKDYDRVLVVDCAEDVQLERLMARDLSSREQAQAILDKQADRKQRLSIADDVIVNDSDLH
SLRQSVITLDNQYRQLARK