Protein Info for B158DRAFT_2139 in Kangiella aquimarina DSM 16071

Annotation: Type II secretory pathway, component PulF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 182 to 204 (23 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details PF00482: T2SSF" amino acids 82 to 205 (124 residues), 128 bits, see alignment E=1.1e-41 amino acids 287 to 408 (122 residues), 110.8 bits, see alignment E=2.2e-36

Best Hits

Swiss-Prot: 58% identical to PILC_PSEAE: Type 4 fimbrial assembly protein PilC (pilC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 84% identity to kko:Kkor_0707)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>B158DRAFT_2139 Type II secretory pathway, component PulF (Kangiella aquimarina DSM 16071)
MATAVKRKSAKASKSKVKLKNFQWTGVNKQGQKIKGKMPAENQDIVKQQLLKQGITPKAI
NAELFSFGGSKKSIKPVDIAVFLRQLAIMMKAGVPLVQSFDIIGKGHENPSVQDLVMDVK
QDVESGNPFAESLRKHPKYFDDLVCDLIHAGEQSGTLEQMLDRIATYKEKSEALKSKIKS
ALMYPAAVVVVSIAVTAILLIYVVPMFSQLFEGAGADLPAFTQMVVDMSENVQQYWYLYL
FVMIGIVVAYSQLNKSSQSFRDGKDKLLLKFPIFGPLIQKAAVARYARTLATTFAAGVPL
VDALDSAAGASGNAVYRDAIKKIKEDVTTGLQINMAMASTGVFPNMVTQMVAIGEESGAV
DTMLAKVADIYEQEVDDAVDGISSLIEPFVIVFLGTVVGGLVVAMYLPVFQMGSAF