Protein Info for B158DRAFT_2138 in Kangiella aquimarina DSM 16071

Annotation: type IV-A pilus assembly ATPase PilB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02538: type IV-A pilus assembly ATPase PilB" amino acids 11 to 570 (560 residues), 850.4 bits, see alignment E=3.4e-260 PF05157: MshEN" amino acids 44 to 147 (104 residues), 61.6 bits, see alignment E=7.7e-21 PF00437: T2SSE" amino acids 194 to 461 (268 residues), 357.9 bits, see alignment E=2.9e-111

Best Hits

Swiss-Prot: 60% identical to PILB_PSEAE: Type 4 fimbrial assembly protein PilB (pilB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02652, type IV pilus assembly protein PilB (inferred from 96% identity to kko:Kkor_0706)

Predicted SEED Role

"Type IV fimbrial assembly, ATPase PilB" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>B158DRAFT_2138 type IV-A pilus assembly ATPase PilB (Kangiella aquimarina DSM 16071)
MTLADTGLSGLAHLLVAEGLLSKEKVQQAVKNAKEEKLGLIDWLVTAGWLEGKQAAKAQA
LNFGYPYFDLSSIAFENIPKDVIDLKLMQAHRAVPLYKRGTRLFVAVSDATNIKSLEEIR
FQTGCSVEAVLVEPNKLEAVVSKLIEEKENETLSDFDDADLDNIDLDAVDPDAEQDMDEG
AGGEDAPVVKFVKQMLVSAIRKGASDLHFEPYEKKYRVRFRIDGMLHEVASPPVQLAGRI
SARLKVLSGLDISERRVPQDGRVKLKISKTKAIDFRVNTLPTLFGEKIVMRILDPSQAML
GIDALGFDPKQKKDFMRAIEKPQGMVLVTGPTGSGKTVTLYTGVNILNDEYKNISTAEDP
VEINLHGINQVNVNVKAGLTFASALRAFLRQDPDIVLVGEIRDLETAEIAIKAAQTGHLV
LSTLHTNSAPETLTRLVNMGVAPFNIATTVNLVVAQRLARRLCEHCKKPSDLPKEALLEE
GFSEEELNELTIYEPVGCDKCTMGYKGRVGLFQVMPVSEENGRIIMEGGNAIDIADQAKK
EGIPDLRRAGLNKVKAGLTSLAEVNRVTQD