Protein Info for B158DRAFT_2134 in Kangiella aquimarina DSM 16071

Annotation: Negative regulator of beta-lactamase expression

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01510: Amidase_2
  • amino acids 32 to 174 (143 residues), 107.2 bits, E=4e-35

Best Hits

Swiss-Prot: 61% identical to AMPD_SALTS: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (ampD) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K03806, AmpD protein (inferred from 86% identity to kko:Kkor_0701)

MetaCyc: 60% identical to 1,6-anhydro-N-acetylmuramoyl-L-alanine amidase (Escherichia coli K-12 substr. MG1655)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) AmpD" (EC 3.5.1.28)

MetaCyc Pathways

• peptidoglycan recycling I (9/14 steps found)
• peptidoglycan recycling II (4/10 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Protein Sequence (188 amino acids)

>B158DRAFT_2134 Negative regulator of beta-lactamase expression (Kangiella aquimarina DSM 16071)
MTEPFYINLATGLIQPARFVPTEHCDEREDPKDISLLIIHNISLPPRQFGGPYIDQLFTG
TLNPSEHPYFEDIAALRVSSHLLIRRNGELVQYVPFHKRAWHAGVSSFEGRQKCNDFSIG
IELEGADDIPYEGIQYLTLAKVTEVILKAYPQINPERIAGHSDIAPGRKTDPGPAFDWSY
YRQLTANG